Lineage for d1te6b2 (1te6 B:1-139)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein Enolase [54828] (10 species)
  7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries)
    Uniprot P09104
  8. Domain d1te6b2: 1te6 B:1-139 [106800]
    Other proteins in same PDB: d1te6a1, d1te6a3, d1te6b1
    complexed with cl, mg, po4, trs

Details for d1te6b2

PDB Entry: 1te6 (more details), 1.8 Å

PDB Description: Crystal Structure of Human Neuron Specific Enolase at 1.8 angstrom
PDB Compounds: (B:) Gamma enolase

SCOPe Domain Sequences for d1te6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te6b2 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d1te6b2 are not available.

Timeline for d1te6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1te6b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1te6a1, d1te6a2, d1te6a3