SCOPe 2.08: Domain d1t5wb1: 1t5w B:93-190

Lineage for d1t5wb1 (1t5w B:93-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d1t5wb1: 1t5w B:93-190 [106483]
   Other proteins in same PDB: d1t5wa1, d1t5wa2, d1t5wb2, d1t5wd1, d1t5wd2, d1t5we2

Details for d1t5wb1

PDB Entry: 1t5w, 2.4 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1t5wb1:

Sequence; same for both SEQRES and ATOM records:

>d1t5wb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Timeline for d1t5wb1:

• d1t5wb1 first appeared in SCOP 1.69
  
• d1t5wb1 appears in SCOPe 2.07