Lineage for d1t5wa1 (1t5w A:82-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747358Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 2747374Domain d1t5wa1: 1t5w A:82-181 [106481]
    Other proteins in same PDB: d1t5wa2, d1t5wb1, d1t5wb2, d1t5wd2, d1t5we1, d1t5we2

Details for d1t5wa1

PDB Entry: 1t5w (more details), 2.4 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr)
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1t5wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t5wa1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d1t5wa1:

Click to download the PDB-style file with coordinates for d1t5wa1.
(The format of our PDB-style files is described here.)

Timeline for d1t5wa1: