![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
![]() | Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
![]() | Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
![]() | Protein Leucocidin S component LukS-PV [111373] (1 species) |
![]() | Species Staphylococcus aureus bacteriophage PVL [TaxId:71366] [111374] (1 PDB entry) Uniprot O80066 |
![]() | Domain d1t5rf_: 1t5r F: [106470] |
PDB Entry: 1t5r (more details), 2 Å
SCOPe Domain Sequences for d1t5rf_:
Sequence, based on SEQRES records: (download)
>d1t5rf_ f.6.1.1 (F:) Leucocidin S component LukS-PV {Staphylococcus aureus bacteriophage PVL [TaxId: 71366]} nienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyyn ykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgps tggngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgyk pysqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatrr tthygnsylegsrihnafvnrnytvkyevnwktheikvkghn
>d1t5rf_ f.6.1.1 (F:) Leucocidin S component LukS-PV {Staphylococcus aureus bacteriophage PVL [TaxId: 71366]} nienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyyn ykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgsf nysktisynqqnyisevehqnsksvqwgikansfigkmsghdpnlfvgykpysqnprdyf vpdnelpplvhsgfnpsfiatvshekggdtsefeitygrnmdvthatrrttgnsylegsr ihnafvnrnytvkyevnwktheikvkghn
Timeline for d1t5rf_: