Lineage for d1t5rf_ (1t5r F:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519390Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 519391Superfamily f.6.1: Leukocidin-like [56959] (2 families) (S)
  5. 519392Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (4 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
  6. 519405Protein Leucocidin S component LukS-PV [111373] (1 species)
  7. 519406Species Staphylococcus aureus bacteriophage PVL [TaxId:71366] [111374] (1 PDB entry)
  8. 519412Domain d1t5rf_: 1t5r F: [106470]

Details for d1t5rf_

PDB Entry: 1t5r (more details), 2 Å

PDB Description: structure of the panton-valentine leucocidin s component from staphylococcus aureus

SCOP Domain Sequences for d1t5rf_:

Sequence, based on SEQRES records: (download)

>d1t5rf_ f.6.1.1 (F:) Leucocidin S component LukS-PV {Staphylococcus aureus bacteriophage PVL}
nienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyyn
ykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgps
tggngsfnysktisynqqnyisevehqnsksvqwgikansfitslgkmsghdpnlfvgyk
pysqnprdyfvpdnelpplvhsgfnpsfiatvshekgsgdtsefeitygrnmdvthatrr
tthygnsylegsrihnafvnrnytvkyevnwktheikvkghn

Sequence, based on observed residues (ATOM records): (download)

>d1t5rf_ f.6.1.1 (F:) Leucocidin S component LukS-PV {Staphylococcus aureus bacteriophage PVL}
nienigdgaevvkrtedtssdkwgvtqniqfdfvkdkkynkdalilkmqgfinskttyyn
ykntdhikamrwpfqyniglktndpnvdlinylpknkidsvnvsqtlgyniggnfnsgsf
nysktisynqqnyisevehqnsksvqwgikansfigkmsghdpnlfvgykpysqnprdyf
vpdnelpplvhsgfnpsfiatvshekggdtsefeitygrnmdvthatrrttgnsylegsr
ihnafvnrnytvkyevnwktheikvkghn

SCOP Domain Coordinates for d1t5rf_:

Click to download the PDB-style file with coordinates for d1t5rf_.
(The format of our PDB-style files is described here.)

Timeline for d1t5rf_: