SCOPe 2.01: Domain d1t56a2: 1t56 A:95-214

Lineage for d1t56a2 (1t56 A:95-214)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Ethr repressor [109978] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (3 PDB entries)
   Uniprot P96222 22-215

8. Domain d1t56a2: 1t56 A:95-214 [106429]
   Other proteins in same PDB: d1t56a1
   complexed with dio, gol

Details for d1t56a2

PDB Entry: 1t56, 1.7 Å

PDB Description: Crystal structure of TetR family repressor M. tuberculosis EthR

PDB Compounds: (A:) EthR repressor

SCOPe Domain Sequences for d1t56a2:

Sequence; same for both SEQRES and ATOM records:

>d1t56a2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d1t56a2:

• d1t56a2 first appeared in SCOP 1.69
  
• d1t56a2 appears in SCOP 1.75
  
• d1t56a2 appears in SCOPe 2.02
  
• d1t56a2 appears in the current release, SCOPe 2.08