Lineage for d1t56a2 (1t56 A:95-214)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Ethr repressor [109978] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
Uniprot P96222 22-215
Domain d1t56a2: 1t56 A:95-214 [106429]
Other proteins in same PDB: d1t56a1
complexed with dio, gol
Details for d1t56a2
PDB Entry: 1t56 (more details), 1.7 Å
PDB Description: Crystal structure of TetR family repressor M. tuberculosis EthR
PDB Compounds: (A:) EthR repressorSCOPe Domain Sequences for d1t56a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t56a2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
SCOPe Domain Coordinates for d1t56a2:
Click to download the PDB-style file with coordinates for d1t56a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t56a2:
- d1t56a2 first appeared in SCOP 1.69
- d1t56a2 appears in SCOPe 2.07
View in 3D
