SCOP 1.75: Domain d1t44g_: 1t44 G:

Lineage for d1t44g_ (1t44 G:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (4 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (28 PDB entries)
   Uniprot P20065 55-179

8. Domain d1t44g_: 1t44 G: [106395]
   Other proteins in same PDB: d1t44a1, d1t44a2
   complexed with atp, ca

Details for d1t44g_

PDB Entry: 1t44, 2 Å

PDB Description: structural basis of actin sequestration by thymosin-b4: implications for arp2/3 activation

PDB Compounds: (G:) Chimera of Gelsolin domain 1 and C-Terminal domain of thymosin Beta-4

SCOP Domain Sequences for d1t44g_:

Sequence; same for both SEQRES and ATOM records:

>d1t44g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhvetqeknplpsketieqekq

Timeline for d1t44g_:

• d1t44g_ first appeared in SCOP 1.69
  
• d1t44g_ appears in SCOP 1.73
  
• d1t44g_ appears in SCOPe 2.01
  
• d1t44g_ appears in the current release, SCOPe 2.08