Lineage for d1t3ta7 (1t3t A:817-1033)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670756Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1670757Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1670758Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1670768Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species)
  7. 1670774Species Salmonella typhimurium [TaxId:90371] [111182] (1 PDB entry)
    Uniprot P74881
  8. 1670776Domain d1t3ta7: 1t3t A:817-1033 [106387]
    Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5
    complexed with adp, mg, so4

Details for d1t3ta7

PDB Entry: 1t3t (more details), 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d1t3ta7:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ta7 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 90371]}
pqlstednalllidlgkghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaa
rkllawhdrsdggllvtlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedr
daveallaqygladcvhylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlr
dnpqcadqeheakandtdpglnvklsfdinediaapy

SCOPe Domain Coordinates for d1t3ta7:

Click to download the PDB-style file with coordinates for d1t3ta7.
(The format of our PDB-style files is described here.)

Timeline for d1t3ta7: