SCOPe 2.04: Domain d1t3ta2: 1t3t A:1034-1295

Lineage for d1t3ta2 (1t3t A:1034-1295)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein FGAM synthase PurL, amidotransferase domain [110484] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [110485] (1 PDB entry)
   Uniprot P74881

8. Domain d1t3ta2: 1t3t A:1034-1295 [106382]
   Other proteins in same PDB: d1t3ta1, d1t3ta3, d1t3ta4, d1t3ta5, d1t3ta6, d1t3ta7
   complexed with adp, mg, so4

Details for d1t3ta2

PDB Entry: 1t3t, 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d1t3ta2:

Sequence; same for both SEQRES and ATOM records:

>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]}
iatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvacgg
fsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgsel
wprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaale
skglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvanswh
penwgedspwmrifrnarkqlg

Timeline for d1t3ta2:

• d1t3ta2 first appeared in SCOP 1.69
  
• d1t3ta2 appears in SCOPe 2.03
  
• d1t3ta2 appears in SCOPe 2.05
  
• d1t3ta2 appears in the current release, SCOPe 2.08