Lineage for d1t3eb3 (1t3e B:499-653)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1609848Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 1609849Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 1609930Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
    automatically mapped to Pfam PF00994
  6. 1609931Protein Gephyrin, domain 5 [110647] (1 species)
  7. 1609932Species Norway rat (Rattus norvegicus) [TaxId:10116] [110648] (3 PDB entries)
    Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))
  8. 1609937Domain d1t3eb3: 1t3e B:499-653 [106353]
    Other proteins in same PDB: d1t3ea1, d1t3ea2, d1t3eb1, d1t3eb2
    complexed with so4

Details for d1t3eb3

PDB Entry: 1t3e (more details), 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering
PDB Compounds: (B:) gephyrin

SCOPe Domain Sequences for d1t3eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3eb3 c.57.1.2 (B:499-653) Gephyrin, domain 5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

SCOPe Domain Coordinates for d1t3eb3:

Click to download the PDB-style file with coordinates for d1t3eb3.
(The format of our PDB-style files is described here.)

Timeline for d1t3eb3: