SCOPe 2.04: Domain d1t3eb1: 1t3e B:654-736

Lineage for d1t3eb1 (1t3e B:654-736)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Gephyrin, C-terminal domain [110330] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries)
   Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))

8. Domain d1t3eb1: 1t3e B:654-736 [106351]
   Other proteins in same PDB: d1t3ea2, d1t3ea3, d1t3eb2, d1t3eb3
   complexed with so4

Details for d1t3eb1

PDB Entry: 1t3e, 3.25 Å

PDB Description: Structural basis of dynamic glycine receptor clustering

PDB Compounds: (B:) gephyrin

SCOPe Domain Sequences for d1t3eb1:

Sequence; same for both SEQRES and ATOM records:

>d1t3eb1 b.85.6.1 (B:654-736) Gephyrin, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Timeline for d1t3eb1:

• d1t3eb1 first appeared in SCOP 1.69
  
• d1t3eb1 appears in SCOPe 2.03
  
• d1t3eb1 appears in SCOPe 2.05
  
• d1t3eb1 appears in the current release, SCOPe 2.08