Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) automatically mapped to Pfam PF03454 |
Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
Protein Gephyrin, C-terminal domain [110330] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries) Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101)) |
Domain d1t3eb1: 1t3e B:654-736 [106351] Other proteins in same PDB: d1t3ea2, d1t3ea3, d1t3eb2, d1t3eb3 complexed with so4 |
PDB Entry: 1t3e (more details), 3.25 Å
SCOPe Domain Sequences for d1t3eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3eb1 b.85.6.1 (B:654-736) Gephyrin, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp pkteqyvelhkgevvdvmvigrl
Timeline for d1t3eb1: