SCOPe 2.06: Domain d1t3dc_: 1t3d C:

Lineage for d1t3dc_ (1t3d C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
   this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain

6. Protein Serine acetyltransferase [110310] (2 species)
   extra N-terminal all-alpha subdomain belongs to Pfam PF06426

7. Species Escherichia coli [TaxId:562] [110312] (1 PDB entry)
   Uniprot P05796

8. Domain d1t3dc_: 1t3d C: [106347]
   complexed with cys

Details for d1t3dc_

PDB Entry: 1t3d, 2.2 Å

PDB Description: Crystal structure of Serine Acetyltransferase from E.coli at 2.2A

PDB Compounds: (C:) Serine acetyltransferase

SCOPe Domain Sequences for d1t3dc_:

Sequence; same for both SEQRES and ATOM records:

>d1t3dc_ b.81.1.6 (C:) Serine acetyltransferase {Escherichia coli [TaxId: 562]}
msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
arivgkpdsdkpsmdmdqhfng

Timeline for d1t3dc_:

• d1t3dc_ first appeared in SCOP 1.69
  
• d1t3dc_ appears in SCOPe 2.05
  
• d1t3dc_ appears in SCOPe 2.07
  
• d1t3dc_ appears in the current release, SCOPe 2.08