Lineage for d1t3dc_ (1t3d C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423550Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 2423551Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 2423552Species Escherichia coli [TaxId:562] [110312] (1 PDB entry)
    Uniprot P05796
  8. 2423555Domain d1t3dc_: 1t3d C: [106347]
    complexed with cys

Details for d1t3dc_

PDB Entry: 1t3d (more details), 2.2 Å

PDB Description: Crystal structure of Serine Acetyltransferase from E.coli at 2.2A
PDB Compounds: (C:) Serine acetyltransferase

SCOPe Domain Sequences for d1t3dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3dc_ b.81.1.6 (C:) Serine acetyltransferase {Escherichia coli [TaxId: 562]}
msceeleivwnnikaeartladcepmlasfyhatllkhenlgsalsymlanklsspimpa
iairevveeayaadpemiasaacdiqavrtrdpavdkystpllylkgfhalqayrighwl
wnqgrralaiflqnqvsvtfqvdihpaakigrgimldhatgivvgetaviendvsilqsv
tlggtgksggdrhpkiregvmigagakilgnievgrgakigagsvvlqpvpphttaagvp
arivgkpdsdkpsmdmdqhfng

SCOPe Domain Coordinates for d1t3dc_:

Click to download the PDB-style file with coordinates for d1t3dc_.
(The format of our PDB-style files is described here.)

Timeline for d1t3dc_: