Lineage for d1t2wc_ (1t2w C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965576Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 965577Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 965578Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 965584Protein Sortase A [63819] (1 species)
  7. 965585Species Staphylococcus aureus [TaxId:1280] [63820] (4 PDB entries)
    Uniprot Q9S446 61-206
  8. 965588Domain d1t2wc_: 1t2w C: [106291]
    complexed with leu

Details for d1t2wc_

PDB Entry: 1t2w (more details), 1.8 Å

PDB Description: crystal structure of sortase a in complex with a lpetg peptide
PDB Compounds: (C:) Sortase

SCOPe Domain Sequences for d1t2wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2wc_ b.100.1.1 (C:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
kpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaght
fidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltl
itaddynektgvwekrkifvatevk

SCOPe Domain Coordinates for d1t2wc_:

Click to download the PDB-style file with coordinates for d1t2wc_.
(The format of our PDB-style files is described here.)

Timeline for d1t2wc_: