Class b: All beta proteins [48724] (174 folds) |
Fold b.100: Sortase [63816] (1 superfamily) barrel, closed; n=8, S=10; mixed sheet; two overside connections |
Superfamily b.100.1: Sortase [63817] (1 family) |
Family b.100.1.1: Sortase [63818] (3 proteins) |
Protein Sortase A [63819] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [63820] (4 PDB entries) Uniprot Q9S446 61-206 |
Domain d1t2wc_: 1t2w C: [106291] complexed with leu |
PDB Entry: 1t2w (more details), 1.8 Å
SCOPe Domain Sequences for d1t2wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2wc_ b.100.1.1 (C:) Sortase A {Staphylococcus aureus [TaxId: 1280]} kpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaght fidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltl itaddynektgvwekrkifvatevk
Timeline for d1t2wc_: