![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.100: Sortase [63816] (1 superfamily) barrel, closed; n=8, S=10; mixed sheet; two overside connections |
![]() | Superfamily b.100.1: Sortase [63817] (2 families) ![]() |
![]() | Family b.100.1.1: Sortase [63818] (3 proteins) |
![]() | Protein Sortase A [63819] (2 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries) Uniprot Q9S446 61-206 |
![]() | Domain d1t2wc_: 1t2w C: [106291] complexed with leu |
PDB Entry: 1t2w (more details), 1.8 Å
SCOPe Domain Sequences for d1t2wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2wc_ b.100.1.1 (C:) Sortase A {Staphylococcus aureus [TaxId: 1280]} kpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiaght fidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkqltl itaddynektgvwekrkifvatevk
Timeline for d1t2wc_: