SCOPe 2.01: Domain d1t1ea2: 1t1e A:12-190

Lineage for d1t1ea2 (1t1e A:12-190)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families)

5. Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
   decorated with additional structure

6. Protein Pro-kumamolisin activation domain [110951] (1 species)

7. Species Bacillus sp. MN-32 [TaxId:198803] [110952] (1 PDB entry)
   Uniprot Q8RR56

8. Domain d1t1ea2: 1t1e A:12-190 [106245]
   Other proteins in same PDB: d1t1ea1
   complexed with ca

Details for d1t1ea2

PDB Entry: 1t1e, 1.18 Å

PDB Description: high resolution crystal structure of the intact pro-kumamolisin, a sedolisin type proteinase (previously called kumamolysin or kscp)

PDB Compounds: (A:) kumamolisin

SCOPe Domain Sequences for d1t1ea2:

Sequence; same for both SEQRES and ATOM records:

>d1t1ea2 d.58.3.2 (A:12-190) Pro-kumamolisin activation domain {Bacillus sp. MN-32 [TaxId: 198803]}
ekrevlagharrqapqavdkgpvtgdqrisvtvvlrrqrgdeleahverqaalapharvh
lereafaashgaslddfaeirkfaeahgltldrahvaagtavlsgpvdavnqafgvelrh
fdhpdgsyrsyvgdvrvpasiaplieavlgldtrpvarphfrlrrraegefearsqsaa

Timeline for d1t1ea2:

• d1t1ea2 first appeared in SCOP 1.69
  
• d1t1ea2 appears in SCOP 1.75
  
• d1t1ea2 appears in SCOPe 2.02
  
• d1t1ea2 appears in the current release, SCOPe 2.08