Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) |
Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins) decorated with additional structure |
Protein Pro-kumamolisin activation domain [110951] (1 species) |
Species Bacillus sp. MN-32 [TaxId:198803] [110952] (1 PDB entry) Uniprot Q8RR56 |
Domain d1t1ea2: 1t1e A:12-190 [106245] Other proteins in same PDB: d1t1ea1 complexed with ca |
PDB Entry: 1t1e (more details), 1.18 Å
SCOPe Domain Sequences for d1t1ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1ea2 d.58.3.2 (A:12-190) Pro-kumamolisin activation domain {Bacillus sp. MN-32 [TaxId: 198803]} ekrevlagharrqapqavdkgpvtgdqrisvtvvlrrqrgdeleahverqaalapharvh lereafaashgaslddfaeirkfaeahgltldrahvaagtavlsgpvdavnqafgvelrh fdhpdgsyrsyvgdvrvpasiaplieavlgldtrpvarphfrlrrraegefearsqsaa
Timeline for d1t1ea2: