SCOPe 2.01: Domain d1t1ea1: 1t1e A:192-546

Lineage for d1t1ea1 (1t1e A:192-546)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 proteins)
   elaborated with additional structures

6. Protein Serine-carboxyl proteinase, SCP [52765] (3 species)

7. Species Bacillus novosp. MN-32, kumamolisin [TaxId:198803] [75226] (7 PDB entries)
   Uniprot Q8RR56 ! Uniprot Q8RR56

8. Domain d1t1ea1: 1t1e A:192-546 [106244]
   Other proteins in same PDB: d1t1ea2
   complexed with ca

Details for d1t1ea1

PDB Entry: 1t1e, 1.18 Å

PDB Description: high resolution crystal structure of the intact pro-kumamolisin, a sedolisin type proteinase (previously called kumamolysin or kscp)

PDB Compounds: (A:) kumamolisin

SCOPe Domain Sequences for d1t1ea1:

Sequence; same for both SEQRES and ATOM records:

>d1t1ea1 c.41.1.2 (A:192-546) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]}
ptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvsvd
gatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpthkp
sivsiswggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdfpa
aspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsanp
gagsgrgvpdvagnadpatgyevvidgettviggtaavaplfaalvarinqklgkpvgyl
nptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp

Timeline for d1t1ea1:

• d1t1ea1 first appeared in SCOP 1.69
  
• d1t1ea1 appears in SCOP 1.75
  
• d1t1ea1 appears in SCOPe 2.02
  
• d1t1ea1 appears in the current release, SCOPe 2.08