Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 proteins) elaborated with additional structures |
Protein Serine-carboxyl proteinase, SCP [52765] (3 species) |
Species Bacillus novosp. MN-32, kumamolisin [TaxId:198803] [75226] (7 PDB entries) Uniprot Q8RR56 ! Uniprot Q8RR56 |
Domain d1t1ea1: 1t1e A:192-546 [106244] Other proteins in same PDB: d1t1ea2 complexed with ca |
PDB Entry: 1t1e (more details), 1.18 Å
SCOPe Domain Sequences for d1t1ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1ea1 c.41.1.2 (A:192-546) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} ptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvsvd gatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpthkp sivsiswggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdfpa aspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsanp gagsgrgvpdvagnadpatgyevvidgettviggtaavaplfaalvarinqklgkpvgyl nptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp
Timeline for d1t1ea1: