Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (3 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins) |
Protein Trigger factor PPIase domain [75388] (3 species) |
Species Vibrio cholerae [TaxId:666] [110869] (1 PDB entry) |
Domain d1t11a3: 1t11 A:135-247 [106238] Other proteins in same PDB: d1t11a1, d1t11a2, d1t11b1, d1t11b2 |
PDB Entry: 1t11 (more details), 2.5 Å
SCOP Domain Sequences for d1t11a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae} advaemletlrkqqatwkevdeaaengkrvsidfvgsidgvefeggkaenfplemgagrm ipgfedgivgktkgmefvidvtfpedyhaenlkgkaakfaikvnkvearelpe
Timeline for d1t11a3: