![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein Trigger factor PPIase domain [75388] (3 species) |
![]() | Species Vibrio cholerae [TaxId:666] [110869] (1 PDB entry) Uniprot Q9KQS5 |
![]() | Domain d1t11a3: 1t11 A:135-247 [106238] Other proteins in same PDB: d1t11a1, d1t11a2, d1t11a4, d1t11b1, d1t11b2, d1t11b4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1t11 (more details), 2.5 Å
SCOPe Domain Sequences for d1t11a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} advaemletlrkqqatwkevdeaaengkrvsidfvgsidgvefeggkaenfplemgagrm ipgfedgivgktkgmefvidvtfpedyhaenlkgkaakfaikvnkvearelpe
Timeline for d1t11a3:
![]() Domains from other chains: (mouse over for more information) d1t11b1, d1t11b2, d1t11b3, d1t11b4 |