Lineage for d1t11a1 (1t11 A:248-376)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450734Fold a.223: TF C-terminus (Pfam 05698) [109997] (1 superfamily)
    multihelical; open array
  4. 450735Superfamily a.223.1: TF C-terminus (Pfam 05698) [109998] (1 family) (S)
  5. 450736Family a.223.1.1: TF C-terminus (Pfam 05698) [109999] (1 protein)
    includes the upstream linker region not covered by the Pfam model
  6. 450737Protein Trigger factor, C-terminal domain [110000] (2 species)
  7. 450741Species Vibrio cholerae [TaxId:666] [110002] (1 PDB entry)
  8. 450742Domain d1t11a1: 1t11 A:248-376 [106236]
    Other proteins in same PDB: d1t11a2, d1t11a3, d1t11b2, d1t11b3

Details for d1t11a1

PDB Entry: 1t11 (more details), 2.5 Å

PDB Description: trigger factor

SCOP Domain Sequences for d1t11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t11a1 a.223.1.1 (A:248-376) Trigger factor, C-terminal domain {Vibrio cholerae}
lndefvarfgvaeggvdalkaevrknmerelkqaikarikeqaieglvkeneiqvpsali
dqeinvlrqqaaqrfggnveaaaqlprelfeeqakrrvvvglllgevirthelkadeekv
kalitemat

SCOP Domain Coordinates for d1t11a1:

Click to download the PDB-style file with coordinates for d1t11a1.
(The format of our PDB-style files is described here.)

Timeline for d1t11a1: