Lineage for d1t0rc_ (1t0r C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 500343Superfamily d.15.12: TmoB-like (Pfam 06234) [110814] (1 family) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 500344Family d.15.12.1: TmoB-like (Pfam 06234) [110815] (1 protein)
  6. 500345Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species)
  7. 500346Species Pseudomonas stutzeri [TaxId:316] [110817] (3 PDB entries)
  8. 500348Domain d1t0rc_: 1t0r C: [106225]
    Other proteins in same PDB: d1t0ra_, d1t0rb_

Details for d1t0rc_

PDB Entry: 1t0r (more details), 2.3 Å

PDB Description: Crystal Structure of the Toluene/o-xylene Monooxygenase Hydroxuylase from Pseudomonas stutzeri-azide bound

SCOP Domain Sequences for d1t0rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0rc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri}
atfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtl
fprgmivsdaglrptetldiifmd

SCOP Domain Coordinates for d1t0rc_:

Click to download the PDB-style file with coordinates for d1t0rc_.
(The format of our PDB-style files is described here.)

Timeline for d1t0rc_: