PDB entry 1t0r

View 1t0r on RCSB PDB site
Description: Crystal Structure of the Toluene/o-xylene Monooxygenase Hydroxuylase from Pseudomonas stutzeri-azide bound
Deposited on 2004-04-12, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t0ra_
  • Chain 'B':
    Domains in SCOP 1.69: d1t0rb_
  • Chain 'C':
    Domains in SCOP 1.69: d1t0rc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0rA (A:)
    msmlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvs
    iqrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfaka
    pgnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmm
    mtrdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggp
    slkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewiva
    qferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewlee
    kypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqle
    yegrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgd
    dahdyewvkayqkktnaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0rA (A:)
    smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
    qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
    gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
    trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
    lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
    ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
    ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
    egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
    ahdyewvkayq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0rB (B:)
    mseqqpealkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykk
    ycfdsplkhddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvet
    larfytparylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancy
    pdvgfgkrerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgs
    laqsegdtllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkai
    eaycsalpdgenaiveaksasryvrqmmgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0rB (B:)
    alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
    khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
    arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
    rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
    tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
    pdgenaiveaksasryvrqmmgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t0rC (C:)
    matfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgt
    lfprgmivsdaglrptetldiifmdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0rC (C:)
    atfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtl
    fprgmivsdaglrptetldiifmd