Lineage for d1t0rb_ (1t0r B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441616Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (1 species)
  7. 441617Species Pseudomonas stutzeri [TaxId:316] [109791] (3 PDB entries)
  8. 441619Domain d1t0rb_: 1t0r B: [106224]
    Other proteins in same PDB: d1t0ra_, d1t0rc_

Details for d1t0rb_

PDB Entry: 1t0r (more details), 2.3 Å

PDB Description: Crystal Structure of the Toluene/o-xylene Monooxygenase Hydroxuylase from Pseudomonas stutzeri-azide bound

SCOP Domain Sequences for d1t0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0rb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmgl

SCOP Domain Coordinates for d1t0rb_:

Click to download the PDB-style file with coordinates for d1t0rb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0rb_: