Lineage for d1szia_ (1szi A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 441050Superfamily a.24.23: Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109775] (1 family) (S)
    contains extra alpha+beta subdomain formed by the N- and C-termini.
  5. 441051Family a.24.23.1: Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109776] (1 protein)
  6. 441052Protein Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109777] (1 species)
  7. 441053Species Mouse (Mus musculus) [TaxId:10090] [109778] (1 PDB entry)
  8. 441054Domain d1szia_: 1szi A: [106159]

Details for d1szia_

PDB Entry: 1szi (more details), 2.8 Å

PDB Description: crystal structure of the c-terminus of tip47

SCOP Domain Sequences for d1szia_:

Sequence, based on SEQRES records: (download)

>d1szia_ a.24.23.1 (A:) Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain {Mouse (Mus musculus)}
nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
rqkaqetlqqltsvlglmesvkqgvdqrlgegqeklhqmwlswnqktpqdaekdpakpeq
vearalsmfrditqqlqsmcvalgasiqglpshvreqaqqarsqvndlqatfsgihsfqd
lsagvlaqtreriararealdntveyvaqntpamwlvgpfapgite

Sequence, based on observed residues (ATOM records): (download)

>d1szia_ a.24.23.1 (A:) Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain {Mouse (Mus musculus)}
nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
rqkaqetlqqltsvlglmesvkqakpeqvearalsmfrditqqlqsmcvalgasiqglps
hvreqaqqarsqvndlqatfsgihsfqdlsagvlaqtreriararealdntveyvaqntp
amwlvgpfapgite

SCOP Domain Coordinates for d1szia_:

Click to download the PDB-style file with coordinates for d1szia_.
(The format of our PDB-style files is described here.)

Timeline for d1szia_: