PDB entry 1szi

View 1szi on RCSB PDB site
Description: crystal structure of the c-terminus of tip47
Deposited on 2004-04-05, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.238
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1szia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sziA (A:)
    sgvdrvlvkseawadnrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserl
    rnhayehslgklqnarqkaqetlqqltsvlglmesvkqgvdqrlgegqeklhqmwlswnq
    ktpqdaekdpakpeqvearalsmfrditqqlqsmcvalgasiqglpshvreqaqqarsqv
    ndlqatfsgihsfqdlsagvlaqtreriararealdntveyvaqntpamwlvgpfapgit
    ektpegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sziA (A:)
    nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
    rqkaqetlqqltsvlglmesvkqakpeqvearalsmfrditqqlqsmcvalgasiqglps
    hvreqaqqarsqvndlqatfsgihsfqdlsagvlaqtreriararealdntveyvaqntp
    amwlvgpfapgite