SCOPe 2.08: Domain d1szia_: 1szi A:

Lineage for d1szia_ (1szi A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.23: Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109775] (1 family)
   contains extra alpha+beta subdomain formed by the N- and C-termini.
   automatically mapped to Pfam PF03036

5. Family a.24.23.1: Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109776] (1 protein)

6. Protein Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109777] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109778] (1 PDB entry)
   Uniprot Q9DBG5 206-431

8. Domain d1szia_: 1szi A: [106159]

Details for d1szia_

PDB Entry: 1szi, 2.8 Å

PDB Description: crystal structure of the c-terminus of tip47

PDB Compounds: (A:) mannose-6-phosphate receptor binding protein 1

SCOPe Domain Sequences for d1szia_:

Sequence, based on SEQRES records:

>d1szia_ a.24.23.1 (A:) Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
rqkaqetlqqltsvlglmesvkqgvdqrlgegqeklhqmwlswnqktpqdaekdpakpeq
vearalsmfrditqqlqsmcvalgasiqglpshvreqaqqarsqvndlqatfsgihsfqd
lsagvlaqtreriararealdntveyvaqntpamwlvgpfapgite

Sequence, based on observed residues (ATOM records):

>d1szia_ a.24.23.1 (A:) Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
rqkaqetlqqltsvlglmesvkqakpeqvearalsmfrditqqlqsmcvalgasiqglps
hvreqaqqarsqvndlqatfsgihsfqdlsagvlaqtreriararealdntveyvaqntp
amwlvgpfapgite

Timeline for d1szia_:

• d1szia_ first appeared in SCOP 1.69
  
• d1szia_ appears in SCOPe 2.07