Lineage for d1szia_ (1szi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988349Superfamily a.24.23: Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109775] (1 family) (S)
    contains extra alpha+beta subdomain formed by the N- and C-termini.
    automatically mapped to Pfam PF03036
  5. 1988350Family a.24.23.1: Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109776] (1 protein)
  6. 1988351Protein Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain [109777] (1 species)
  7. 1988352Species Mouse (Mus musculus) [TaxId:10090] [109778] (1 PDB entry)
    Uniprot Q9DBG5 206-431
  8. 1988353Domain d1szia_: 1szi A: [106159]

Details for d1szia_

PDB Entry: 1szi (more details), 2.8 Å

PDB Description: Crystal Structure of the C-terminus of TIP47
PDB Compounds: (A:) mannose-6-phosphate receptor binding protein 1

SCOPe Domain Sequences for d1szia_:

Sequence, based on SEQRES records: (download)

>d1szia_ a.24.23.1 (A:) Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
rqkaqetlqqltsvlglmesvkqgvdqrlgegqeklhqmwlswnqktpqdaekdpakpeq
vearalsmfrditqqlqsmcvalgasiqglpshvreqaqqarsqvndlqatfsgihsfqd
lsagvlaqtreriararealdntveyvaqntpamwlvgpfapgite

Sequence, based on observed residues (ATOM records): (download)

>d1szia_ a.24.23.1 (A:) Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
rqkaqetlqqltsvlglmesvkqakpeqvearalsmfrditqqlqsmcvalgasiqglps
hvreqaqqarsqvndlqatfsgihsfqdlsagvlaqtreriararealdntveyvaqntp
amwlvgpfapgite

SCOPe Domain Coordinates for d1szia_:

Click to download the PDB-style file with coordinates for d1szia_.
(The format of our PDB-style files is described here.)

Timeline for d1szia_: