SCOPe 2.06: Domain d1syoa1: 1syo A:7-129

Lineage for d1syoa1 (1syo A:7-129)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
   barrel, partly open; n*=8, S*=10; one psi loop

4. Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family)

5. Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)

6. Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
   Uniprot P08169 49-476

8. Domain d1syoa1: 1syo A:7-129 [106118]
   complexed with gol, m6p, nag

Details for d1syoa1

PDB Entry: 1syo, 2.2 Å

PDB Description: n-terminal 3 domains of ci-mpr bound to mannose 6-phosphate

PDB Compounds: (A:) Cation-Independent Mannose 6-phosphate receptor

SCOPe Domain Sequences for d1syoa1:

Sequence; same for both SEQRES and ATOM records:

>d1syoa1 b.64.1.1 (A:7-129) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
aefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsllk
tasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrttaackkn
ifk

Timeline for d1syoa1:

• d1syoa1 first appeared in SCOP 1.69
  
• d1syoa1 appears in SCOPe 2.05
  
• d1syoa1 appears in SCOPe 2.07
  
• d1syoa1 appears in the current release, SCOPe 2.08