![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily) barrel, partly open; n*=8, S*=10; one psi loop |
![]() | Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) ![]() |
![]() | Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins) |
![]() | Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries) Uniprot P08169 49-476 |
![]() | Domain d1syoa1: 1syo A:7-129 [106118] complexed with gol, m6p, nag |
PDB Entry: 1syo (more details), 2.2 Å
SCOPe Domain Sequences for d1syoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1syoa1 b.64.1.1 (A:7-129) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]} aefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsllk tasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrttaackkn ifk
Timeline for d1syoa1: