Lineage for d1syob3 (1syo B:1281-1432)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397805Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2397806Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2397807Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2397836Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 2397839Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
    Uniprot P08169 49-476
  8. 2397854Domain d1syob3: 1syo B:1281-1432 [106123]
    complexed with gol, m6p, nag

Details for d1syob3

PDB Entry: 1syo (more details), 2.2 Å

PDB Description: N-terminal 3 domains of CI-MPR bound to mannose 6-phosphate
PDB Compounds: (B:) Cation-Independent Mannose 6-phosphate receptor

SCOPe Domain Sequences for d1syob3:

Sequence, based on SEQRES records: (download)

>d1syob3 b.64.1.1 (B:1281-1432) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
hrdylesrscslssaqhdvavdlqplsrveasdslfytseadeytyylsicggsqapicn
kkdaavcqvkkadstqvkvagrpqnltlrysdgdltliyfggeecssgfqrmsvinfecn
qtagnngrgapvftgevdctyfftwdtkyacv

Sequence, based on observed residues (ATOM records): (download)

>d1syob3 b.64.1.1 (B:1281-1432) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
hrdylesrscslssaqhdvavdlqplsrvslfytseadeytyylsicggsqapicnkkda
avcqvkkadstqvkvagrpqnltlrysdgdltliyfggeecssgfqrmsvinfecnqtag
nngrgapvftgevdctyfftwdtkyacv

SCOPe Domain Coordinates for d1syob3:

Click to download the PDB-style file with coordinates for d1syob3.
(The format of our PDB-style files is described here.)

Timeline for d1syob3: