Lineage for d1sxwa_ (1sxw A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395398Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2395718Protein Nitrophorin 4 [50845] (1 species)
  7. 2395719Species Rhodnius prolixus [TaxId:13249] [50846] (49 PDB entries)
    Uniprot Q94734 22-205
  8. 2395739Domain d1sxwa_: 1sxw A: [106104]
    complexed with hem, no, po4; mutant

Details for d1sxwa_

PDB Entry: 1sxw (more details), 1.05 Å

PDB Description: 1.05 A Crystal Structure of D30A Mutant of Nitrophorin 4 from Rhodnius Prolixus Complexed with Nitric Oxide
PDB Compounds: (A:) Nitrophorin 4

SCOPe Domain Sequences for d1sxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxwa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdylalepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOPe Domain Coordinates for d1sxwa_:

Click to download the PDB-style file with coordinates for d1sxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1sxwa_: