SCOPe 2.03: Domain d1sxea_: 1sxe A:

Lineage for d1sxea_ (1sxe A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (6 proteins)

6. Protein Transcriptional regulator ERG [109869] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109870] (1 PDB entry)
   Uniprot P11308 115-208

8. Domain d1sxea_: 1sxe A: [106080]

Details for d1sxea_

PDB Entry: 1sxe

PDB Description: the solution structure of the pointed (pnt) domain from the transcrition factor erg

PDB Compounds: (A:) Transcriptional regulator ERG

SCOPe Domain Sequences for d1sxea_:

Sequence; same for both SEQRES and ATOM records:

>d1sxea_ a.60.1.1 (A:) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]}
gshmeekhmpppnmttnerrvivpadptlwstdhvrqwlewavkeyglpdvnillfqnid
gkelckmtkddfqrltpsynadillshlhylretplp

Timeline for d1sxea_:

• d1sxea_ first appeared in SCOP 1.69
  
• d1sxea_ appears in SCOPe 2.02
  
• d1sxea_ appears in SCOPe 2.04
  
• d1sxea_ appears in the current release, SCOPe 2.08, called d1sxea1