![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) ![]() |
![]() | Family a.60.1.1: Pointed domain [47770] (6 proteins) |
![]() | Protein Transcriptional regulator ERG [109869] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109870] (1 PDB entry) |
![]() | Domain d1sxea_: 1sxe A: [106080] |
PDB Entry: 1sxe (more details)
SCOP Domain Sequences for d1sxea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxea_ a.60.1.1 (A:) Transcriptional regulator ERG {Human (Homo sapiens)} gshmeekhmpppnmttnerrvivpadptlwstdhvrqwlewavkeyglpdvnillfqnid gkelckmtkddfqrltpsynadillshlhylretplp
Timeline for d1sxea_: