Lineage for d1sxea1 (1sxe A:108-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1998616Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1998617Family a.60.1.1: Pointed domain [47770] (7 protein domains)
  6. 1998655Protein Transcriptional regulator ERG [109869] (1 species)
  7. 1998656Species Human (Homo sapiens) [TaxId:9606] [109870] (1 PDB entry)
    Uniprot P11308 115-208
  8. 1998657Domain d1sxea1: 1sxe A:108-201 [106080]
    Other proteins in same PDB: d1sxea2

Details for d1sxea1

PDB Entry: 1sxe (more details)

PDB Description: The solution structure of the Pointed (PNT) domain from the transcrition factor Erg
PDB Compounds: (A:) Transcriptional regulator ERG

SCOPe Domain Sequences for d1sxea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxea1 a.60.1.1 (A:108-201) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]}
meekhmpppnmttnerrvivpadptlwstdhvrqwlewavkeyglpdvnillfqnidgke
lckmtkddfqrltpsynadillshlhylretplp

SCOPe Domain Coordinates for d1sxea1:

Click to download the PDB-style file with coordinates for d1sxea1.
(The format of our PDB-style files is described here.)

Timeline for d1sxea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sxea2