SCOPe 2.08: Domain d1sxea1: 1sxe A:108-201

Lineage for d1sxea1 (1sxe A:108-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Transcriptional regulator ERG [109869] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109870] (1 PDB entry)
   Uniprot P11308 115-208

8. Domain d1sxea1: 1sxe A:108-201 [106080]
   Other proteins in same PDB: d1sxea2

Details for d1sxea1

PDB Entry: 1sxe

PDB Description: the solution structure of the pointed (pnt) domain from the transcrition factor erg

PDB Compounds: (A:) Transcriptional regulator ERG

SCOPe Domain Sequences for d1sxea1:

Sequence; same for both SEQRES and ATOM records:

>d1sxea1 a.60.1.1 (A:108-201) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]}
meekhmpppnmttnerrvivpadptlwstdhvrqwlewavkeyglpdvnillfqnidgke
lckmtkddfqrltpsynadillshlhylretplp

Timeline for d1sxea1:

• d1sxea1 first appeared in SCOP 1.69, called d1sxea_
  
• d1sxea1 appears in SCOPe 2.07