Lineage for d1sxea_ (1sxe A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770824Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) (S)
  5. 770825Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 770856Protein Transcriptional regulator ERG [109869] (1 species)
  7. 770857Species Human (Homo sapiens) [TaxId:9606] [109870] (1 PDB entry)
    Uniprot P11308 115-208
  8. 770858Domain d1sxea_: 1sxe A: [106080]

Details for d1sxea_

PDB Entry: 1sxe (more details)

PDB Description: the solution structure of the pointed (pnt) domain from the transcrition factor erg
PDB Compounds: (A:) Transcriptional regulator ERG

SCOP Domain Sequences for d1sxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxea_ a.60.1.1 (A:) Transcriptional regulator ERG {Human (Homo sapiens) [TaxId: 9606]}
gshmeekhmpppnmttnerrvivpadptlwstdhvrqwlewavkeyglpdvnillfqnid
gkelckmtkddfqrltpsynadillshlhylretplp

SCOP Domain Coordinates for d1sxea_:

Click to download the PDB-style file with coordinates for d1sxea_.
(The format of our PDB-style files is described here.)

Timeline for d1sxea_: