Lineage for d1sw1a_ (1sw1 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1186000Protein Osmoprotection protein ProX [110750] (1 species)
    functionally related to the bacterial ProX
  7. 1186001Species Archaeoglobus fulgidus [TaxId:2234] [110751] (5 PDB entries)
    Uniprot O29280 # AF0982
  8. 1186007Domain d1sw1a_: 1sw1 A: [106062]
    complexed with pbe, zn

Details for d1sw1a_

PDB Entry: 1sw1 (more details), 1.9 Å

PDB Description: crystal structure of prox from archeoglobus fulgidus in complex with proline betaine
PDB Compounds: (A:) osmoprotection protein (proX)

SCOPe Domain Sequences for d1sw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sw1a_ c.94.1.1 (A:) Osmoprotection protein ProX {Archaeoglobus fulgidus [TaxId: 2234]}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk

SCOPe Domain Coordinates for d1sw1a_:

Click to download the PDB-style file with coordinates for d1sw1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sw1a_: