Lineage for d1sv0c_ (1sv0 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272163Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 1272196Protein Modulator of the activity of Ets (MAE, CG15085-PA) [109865] (1 species)
  7. 1272197Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109866] (1 PDB entry)
    Uniprot Q9I7G2 94-173
  8. 1272198Domain d1sv0c_: 1sv0 C: [106037]
    Other proteins in same PDB: d1sv0a_, d1sv0b_

Details for d1sv0c_

PDB Entry: 1sv0 (more details), 2.07 Å

PDB Description: crystal structure of yan-sam/mae-sam complex
PDB Compounds: (C:) modulator of the activity of Ets CG15085-PA

SCOPe Domain Sequences for d1sv0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv0c_ a.60.1.1 (C:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
plgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcr
vpvggkmlyrdfrvrlaramsr

SCOPe Domain Coordinates for d1sv0c_:

Click to download the PDB-style file with coordinates for d1sv0c_.
(The format of our PDB-style files is described here.)

Timeline for d1sv0c_: