Lineage for d1sv0c_ (1sv0 C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444235Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 444236Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 444260Protein Modulator of the activity of Ets (MAE, CG15085-PA) [109865] (1 species)
  7. 444261Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109866] (1 PDB entry)
  8. 444262Domain d1sv0c_: 1sv0 C: [106037]
    Other proteins in same PDB: d1sv0a_, d1sv0b_

Details for d1sv0c_

PDB Entry: 1sv0 (more details), 2.07 Å

PDB Description: Crystal Structure Of Yan-SAM/Mae-SAM Complex

SCOP Domain Sequences for d1sv0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv0c_ a.60.1.1 (C:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster)}
plgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcr
vpvggkmlyrdfrvrlaramsr

SCOP Domain Coordinates for d1sv0c_:

Click to download the PDB-style file with coordinates for d1sv0c_.
(The format of our PDB-style files is described here.)

Timeline for d1sv0c_: