SCOPe 2.08: Domain d1sv0c1: 1sv0 C:94-173

Lineage for d1sv0c1 (1sv0 C:94-173)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Modulator of the activity of Ets (MAE, CG15085-PA) [109865] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109866] (1 PDB entry)
   Uniprot Q9I7G2 94-173

8. Domain d1sv0c1: 1sv0 C:94-173 [106037]
   Other proteins in same PDB: d1sv0a1, d1sv0a2, d1sv0b1, d1sv0b2, d1sv0c2, d1sv0d2

Details for d1sv0c1

PDB Entry: 1sv0, 2.07 Å

PDB Description: crystal structure of yan-sam/mae-sam complex

PDB Compounds: (C:) modulator of the activity of Ets CG15085-PA

SCOPe Domain Sequences for d1sv0c1:

Sequence; same for both SEQRES and ATOM records:

>d1sv0c1 a.60.1.1 (C:94-173) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
plgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcr
vpvggkmlyrdfrvrlaram

Timeline for d1sv0c1:

• d1sv0c1 first appeared in SCOP 1.69, called d1sv0c_
  
• d1sv0c1 appears in SCOPe 2.07