Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
Protein IscU homolog SPy0289 [110925] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [110926] (1 PDB entry) Uniprot Q9A1G2 |
Domain d1su0b_: 1su0 B: [106015] Structural genomics target complexed with zn |
PDB Entry: 1su0 (more details), 2.3 Å
SCOPe Domain Sequences for d1su0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1su0b_ d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus pyogenes [TaxId: 1314]} lnhlymavvadhskrphhhgqldgveavqlnnptcgdvisltvkfdedkiediafagngc tistasssmmtdavigkskeealaladifsemvqgqenpaqkelgeaellagvakfpqri kcstlawnalkeaikr
Timeline for d1su0b_: