Lineage for d1su0b_ (1su0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007715Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)
  6. 3007719Protein IscU homolog SPy0289 [110925] (1 species)
  7. 3007720Species Streptococcus pyogenes [TaxId:1314] [110926] (1 PDB entry)
    Uniprot Q9A1G2
  8. 3007721Domain d1su0b_: 1su0 B: [106015]
    Structural genomics target
    complexed with zn

Details for d1su0b_

PDB Entry: 1su0 (more details), 2.3 Å

PDB Description: Crystal structure of a hypothetical protein at 2.3 A resolution
PDB Compounds: (B:) NifU like protein IscU

SCOPe Domain Sequences for d1su0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su0b_ d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus pyogenes [TaxId: 1314]}
lnhlymavvadhskrphhhgqldgveavqlnnptcgdvisltvkfdedkiediafagngc
tistasssmmtdavigkskeealaladifsemvqgqenpaqkelgeaellagvakfpqri
kcstlawnalkeaikr

SCOPe Domain Coordinates for d1su0b_:

Click to download the PDB-style file with coordinates for d1su0b_.
(The format of our PDB-style files is described here.)

Timeline for d1su0b_: