PDB entry 1su0

View 1su0 on RCSB PDB site
Description: Crystal structure of a hypothetical protein at 2.3 A resolution
Class: structural genomics, unknown function
Keywords: NifU, IscU, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, UNKNOWN FUNCTION
Deposited on 2004-03-25, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: NifU like protein IscU
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1su0b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1su0B (B:)
    malsklnhlymavvadhskrphhhgqldgveavqlnnptcgdvisltvkfdedkiediaf
    agngctistasssmmtdavigkskeealaladifsemvqgqenpaqkelgeaellagvak
    fpqrikcstlawnalkeaikrsanaqhltdqnvkegknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1su0B (B:)
    lnhlymavvadhskrphhhgqldgveavqlnnptcgdvisltvkfdedkiediafagngc
    tistasssmmtdavigkskeealaladifsemvqgqenpaqkelgeaellagvakfpqri
    kcstlawnalkeaikr