SCOP 1.69: Domain d1su0b_: 1su0 B:

Lineage for d1su0b_ (1su0 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (2 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (2 proteins)

6. Protein IscU homolog SPy0289 [110925] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [110926] (1 PDB entry)

8. Domain d1su0b_: 1su0 B: [106015]
   Structural genomics target

Details for d1su0b_

PDB Entry: 1su0, 2.3 Å

PDB Description: Crystal structure of a hypothetical protein at 2.3 A resolution

SCOP Domain Sequences for d1su0b_:

Sequence; same for both SEQRES and ATOM records:

>d1su0b_ d.224.1.2 (B:) IscU homolog SPy0289 {Streptococcus pyogenes}
lnhlymavvadhskrphhhgqldgveavqlnnptcgdvisltvkfdedkiediafagngc
tistasssmmtdavigkskeealaladifsemvqgqenpaqkelgeaellagvakfpqri
kcstlawnalkeaikr

Timeline for d1su0b_:

• d1su0b_ is new in SCOP 1.69
  
• d1su0b_ appears in SCOP 1.71
  
• d1su0b_ appears in the current release, SCOPe 2.08