SCOPe 2.07: Domain d1ssmf_: 1ssm F:

Lineage for d1ssmf_ (1ssm F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
   this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain

6. Protein Serine acetyltransferase [110310] (2 species)
   extra N-terminal all-alpha subdomain belongs to Pfam PF06426

7. Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
   Uniprot P43886 1-241

8. Domain d1ssmf_: 1ssm F: [105992]

Details for d1ssmf_

PDB Entry: 1ssm, 2.15 Å

PDB Description: Serine Acetyltransferase- Apoenzyme (truncated)

PDB Compounds: (F:) Serine acetyltransferase

SCOPe Domain Sequences for d1ssmf_:

Sequence; same for both SEQRES and ATOM records:

>d1ssmf_ b.81.1.6 (F:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

Timeline for d1ssmf_:

• d1ssmf_ first appeared in SCOP 1.69
  
• d1ssmf_ appears in SCOPe 2.06
  
• d1ssmf_ appears in the current release, SCOPe 2.08