Lineage for d1ssmf_ (1ssm F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814104Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 2814105Protein Serine acetyltransferase [110310] (2 species)
    extra N-terminal all-alpha subdomain belongs to Pfam PF06426
  7. 2814110Species Haemophilus influenzae [TaxId:727] [110311] (4 PDB entries)
    Uniprot P43886 1-241
  8. 2814121Domain d1ssmf_: 1ssm F: [105992]

Details for d1ssmf_

PDB Entry: 1ssm (more details), 2.15 Å

PDB Description: Serine Acetyltransferase- Apoenzyme (truncated)
PDB Compounds: (F:) Serine acetyltransferase

SCOPe Domain Sequences for d1ssmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ssmf_ b.81.1.6 (F:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}
mtldvwqhirqeakelaenepmlasffhstilkhqnlggalsyllanklanpimpaislr
eiieeayqsnpsiidcaacdiqavrhrdpavelwstpllylkgfhaiqsyrithylwnqn
rkslalylqnqisvafdvdihpaakighgimfdhatgivvgetsviendvsilqgvtlgg
tgkesgdrhpkvregvmigagakilgnievgkyakigansvvlnpvpeyataagvpariv

SCOPe Domain Coordinates for d1ssmf_:

Click to download the PDB-style file with coordinates for d1ssmf_.
(The format of our PDB-style files is described here.)

Timeline for d1ssmf_: