SCOPe 2.06: Domain d1sr4c_: 1sr4 C:

Lineage for d1sr4c_ (1sr4 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Cytolethal distending toxin subunit C [110209] (2 species)

7. Species Haemophilus ducreyi [TaxId:730] [110210] (1 PDB entry)
   Uniprot O06524 25-178

8. Domain d1sr4c_: 1sr4 C: [105950]
   Other proteins in same PDB: d1sr4a_, d1sr4b_
   complexed with br

Details for d1sr4c_

PDB Entry: 1sr4, 2 Å

PDB Description: Crystal Structure of the Haemophilus ducreyi cytolethal distending toxin

PDB Compounds: (C:) cytolethal distending toxin protein C

SCOPe Domain Sequences for d1sr4c_:

Sequence; same for both SEQRES and ATOM records:

>d1sr4c_ b.42.2.1 (C:) Cytolethal distending toxin subunit C {Haemophilus ducreyi [TaxId: 730]}
dpttypdvelsppprislrslltaqpvkndhydshnylsthwelidykgkeyeklrdggt
lvqfkvvgaakcfaflgkgttdckdtdhtvfnliptntgaflikdallgfcitshdfddl
klepcggsvsgrtfslayqwgilppfgpskilip

Timeline for d1sr4c_:

• d1sr4c_ first appeared in SCOP 1.69
  
• d1sr4c_ appears in SCOPe 2.05
  
• d1sr4c_ appears in SCOPe 2.07
  
• d1sr4c_ appears in the current release, SCOPe 2.08