Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) |
Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein) adopts thermolysin-like fold |
Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64340] (15 PDB entries) Uniprot P09960 |
Domain d1sqma3: 1sqm A:209-460 [105943] Other proteins in same PDB: d1sqma1, d1sqma2 complexed with acy, imd, yb, zn; mutant |
PDB Entry: 1sqm (more details), 2.3 Å
SCOP Domain Sequences for d1sqma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqma3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d1sqma3: