Class a: All alpha proteins [46456] (289 folds) |
Fold a.79: NusB-like [48012] (1 superfamily) 6 helices: bundle; one central helix is surrounded by 5 others |
Superfamily a.79.1: NusB-like [48013] (3 families) |
Family a.79.1.3: RmsB N-terminal domain-like [109930] (1 protein) automatically mapped to Pfam PF01029 |
Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain [109931] (1 species) |
Species Escherichia coli [TaxId:562] [109932] (2 PDB entries) Uniprot P36929 |
Domain d1sqga1: 1sqg A:5-144 [105912] Other proteins in same PDB: d1sqga2 |
PDB Entry: 1sqg (more details), 1.65 Å
SCOPe Domain Sequences for d1sqga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqga1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli [TaxId: 562]} rnlrsmaaqaveqvveqgqslsnilpplqqkvsdkdkallqelcfgvlrtlsqldwlink lmarpmtgkqrtvhylimvglyqllytripphaalaetvegaiaikrpqlkglingvlrq fqrqqeellaefnasdaryl
Timeline for d1sqga1: