SCOP 1.69: Domain d1sqga1: 1sqg A:5-144

Lineage for d1sqga1 (1sqg A:5-144)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (3 families)

5. Family a.79.1.3: RmsB N-terminal domain-like [109930] (1 protein)

6. Protein Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain [109931] (1 species)

7. Species Escherichia coli [TaxId:562] [109932] (2 PDB entries)

8. Domain d1sqga1: 1sqg A:5-144 [105912]
   Other proteins in same PDB: d1sqga2

Details for d1sqga1

PDB Entry: 1sqg, 1.65 Å

PDB Description: The crystal structure of the E. coli Fmu apoenzyme at 1.65 A resolution

SCOP Domain Sequences for d1sqga1:

Sequence; same for both SEQRES and ATOM records:

>d1sqga1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli}
rnlrsmaaqaveqvveqgqslsnilpplqqkvsdkdkallqelcfgvlrtlsqldwlink
lmarpmtgkqrtvhylimvglyqllytripphaalaetvegaiaikrpqlkglingvlrq
fqrqqeellaefnasdaryl

Timeline for d1sqga1:

• d1sqga1 is new in SCOP 1.69
  
• d1sqga1 appears in SCOP 1.71
  
• d1sqga1 appears in the current release, SCOPe 2.08