Lineage for d1sl6c_ (1sl6 C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226357Protein DC-SIGNR (DC-SIGN related receptor) [69857] (1 species)
  7. 1226358Species Human (Homo sapiens) [TaxId:9606] [69858] (4 PDB entries)
    Uniprot Q9NNX6 219-397
  8. 1226364Domain d1sl6c_: 1sl6 C: [105714]
    contains two repeats of neck
    complexed with ca

Details for d1sl6c_

PDB Entry: 1sl6 (more details), 2.25 Å

PDB Description: crystal structure of a fragment of dc-signr (containg the carbohydrate recognition domain and two repeats of the neck) complexed with lewis- x.
PDB Compounds: (C:) C-type lectin DC-SIGNR

SCOPe Domain Sequences for d1sl6c_:

Sequence, based on SEQRES records: (download)

>d1sl6c_ d.169.1.1 (C:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
peksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtffqgn
cyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegt
wqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

Sequence, based on observed residues (ATOM records): (download)

>d1sl6c_ d.169.1.1 (C:) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]}
peksklqeiyqeltqlkqqqiyqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnw
hdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplsp
sfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaacfr

SCOPe Domain Coordinates for d1sl6c_:

Click to download the PDB-style file with coordinates for d1sl6c_.
(The format of our PDB-style files is described here.)

Timeline for d1sl6c_: